Lineage for d1t6la1 (1t6l A:10-135)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2215978Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2216127Protein UL44 [111176] (2 species)
  7. 2216135Species Human cytomegalovirus, HHV-5 [TaxId:10359] [111177] (2 PDB entries)
    Uniprot P16790 1-290
  8. 2216136Domain d1t6la1: 1t6l A:10-135 [106574]

Details for d1t6la1

PDB Entry: 1t6l (more details), 1.85 Å

PDB Description: Crystal Structure of the Human Cytomegalovirus DNA Polymerase Subunit, UL44
PDB Compounds: (A:) DNA polymerase processivity factor

SCOPe Domain Sequences for d1t6la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6la1 d.131.1.2 (A:10-135) UL44 {Human cytomegalovirus, HHV-5 [TaxId: 10359]}
pptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskitfnsscly
itdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfnmefssac
vhgqdi

SCOPe Domain Coordinates for d1t6la1:

Click to download the PDB-style file with coordinates for d1t6la1.
(The format of our PDB-style files is described here.)

Timeline for d1t6la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6la2