SCOP 1.71: Domain d1t6la1: 1t6l A:10-135

Lineage for d1t6la1 (1t6l A:10-135)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein UL44 [111176] (1 species)

7. Species Human cytomegalovirus HHV-5 [111177] (1 PDB entry)

8. Domain d1t6la1: 1t6l A:10-135 [106574]

Details for d1t6la1

PDB Entry: 1t6l, 1.85 Å

PDB Description: Crystal Structure of the Human Cytomegalovirus DNA Polymerase Subunit, UL44

SCOP Domain Sequences for d1t6la1:

Sequence; same for both SEQRES and ATOM records:

>d1t6la1 d.131.1.2 (A:10-135) UL44 {Human cytomegalovirus HHV-5}
pptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskitfnsscly
itdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfnmefssac
vhgqdi

Timeline for d1t6la1:

• d1t6la1 first appeared in SCOP 1.69
  
• d1t6la1 appears in SCOP 1.73
  
• d1t6la1 appears in the current release, SCOPe 2.08