Lineage for d1t6la1 (1t6l A:10-135)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511273Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 511274Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 511311Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 511389Protein UL44 [111176] (1 species)
  7. 511390Species Human cytomegalovirus HHV-5 [111177] (1 PDB entry)
  8. 511391Domain d1t6la1: 1t6l A:10-135 [106574]

Details for d1t6la1

PDB Entry: 1t6l (more details), 1.85 Å

PDB Description: Crystal Structure of the Human Cytomegalovirus DNA Polymerase Subunit, UL44

SCOP Domain Sequences for d1t6la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6la1 d.131.1.2 (A:10-135) UL44 {Human cytomegalovirus HHV-5}
pptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskitfnsscly
itdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfnmefssac
vhgqdi

SCOP Domain Coordinates for d1t6la1:

Click to download the PDB-style file with coordinates for d1t6la1.
(The format of our PDB-style files is described here.)

Timeline for d1t6la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6la2