Lineage for d1t6ic_ (1t6i C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638393Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
  5. 638394Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (1 protein)
  6. 638395Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 638396Species Streptomyces coelicolor [TaxId:1902] [109774] (3 PDB entries)
  8. 638414Domain d1t6ic_: 1t6i C: [106573]
    mutant

Details for d1t6ic_

PDB Entry: 1t6i (more details), 2.81 Å

PDB Description: Nickel Superoxide Dismutase (NiSOD) Apo Structure
PDB Compounds: (C:) Superoxide dismutase [Ni]

SCOP Domain Sequences for d1t6ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6ic_ a.24.22.1 (C:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces coelicolor [TaxId: 1902]}
vydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpph
fekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk

SCOP Domain Coordinates for d1t6ic_:

Click to download the PDB-style file with coordinates for d1t6ic_.
(The format of our PDB-style files is described here.)

Timeline for d1t6ic_: