Class b: All beta proteins [48724] (149 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
Protein Xylanase II [49979] (16 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Aspergillus kawachii [TaxId:40384] [49988] (2 PDB entries) |
Domain d1t6gd_: 1t6g D: [106570] Other proteins in same PDB: d1t6ga_, d1t6gb_ complexed with gol |
PDB Entry: 1t6g (more details), 1.8 Å
SCOP Domain Sequences for d1t6gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6gd_ b.29.1.11 (D:) Xylanase II {Aspergillus kawachii} aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt is
Timeline for d1t6gd_: