Lineage for d1t6gd_ (1t6g D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556586Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 556625Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 556626Species Aspergillus kawachii [TaxId:40384] [49988] (2 PDB entries)
  8. 556628Domain d1t6gd_: 1t6g D: [106570]
    Other proteins in same PDB: d1t6ga_, d1t6gb_
    complexed with gol

Details for d1t6gd_

PDB Entry: 1t6g (more details), 1.8 Å

PDB Description: crystal structure of the triticum aestivum xylanase inhibitor-i in complex with aspergillus niger xylanase-i

SCOP Domain Sequences for d1t6gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6gd_ b.29.1.11 (D:) Xylanase II {Aspergillus kawachii}
aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
is

SCOP Domain Coordinates for d1t6gd_:

Click to download the PDB-style file with coordinates for d1t6gd_.
(The format of our PDB-style files is described here.)

Timeline for d1t6gd_: