![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein Xylanase II [49979] (19 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Aspergillus kawachii [TaxId:40384] [49988] (4 PDB entries) Uniprot P55328 29-210 # 100% sequence identity; Aspergillus awamori TaxID: 105351 |
![]() | Domain d1t6gc_: 1t6g C: [106569] Other proteins in same PDB: d1t6ga_, d1t6gb_ complexed with gol |
PDB Entry: 1t6g (more details), 1.8 Å
SCOPe Domain Sequences for d1t6gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6gc_ b.29.1.11 (C:) Xylanase II {Aspergillus kawachii [TaxId: 40384]} aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt is
Timeline for d1t6gc_: