SCOP 1.69: Domain d1t6gc_: 1t6g C:

Lineage for d1t6gc_ (1t6g C:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Aspergillus kawachii [TaxId:40384] [49988] (2 PDB entries)

8. Domain d1t6gc_: 1t6g C: [106569]
   Other proteins in same PDB: d1t6ga_, d1t6gb_

Details for d1t6gc_

PDB Entry: 1t6g, 1.8 Å

PDB Description: crystal structure of the triticum aestivum xylanase inhibitor-i in complex with aspergillus niger xylanase-i

SCOP Domain Sequences for d1t6gc_:

Sequence; same for both SEQRES and ATOM records:

>d1t6gc_ b.29.1.11 (C:) Xylanase II {Aspergillus kawachii}
aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
is

Timeline for d1t6gc_:

• d1t6gc_ is new in SCOP 1.69
  
• d1t6gc_ appears in SCOP 1.71
  
• d1t6gc_ appears in the current release, SCOPe 2.08