Lineage for d1t6gc_ (1t6g C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460534Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 protein domains)
  6. 460573Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 460574Species Aspergillus kawachii [TaxId:40384] [49988] (2 PDB entries)
  8. 460575Domain d1t6gc_: 1t6g C: [106569]
    Other proteins in same PDB: d1t6ga_, d1t6gb_

Details for d1t6gc_

PDB Entry: 1t6g (more details), 1.8 Å

PDB Description: Crystal structure of the Triticum aestivum xylanase inhibitor-I in complex with aspergillus niger xylanase-I

SCOP Domain Sequences for d1t6gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6gc_ b.29.1.11 (C:) Xylanase II {Aspergillus kawachii}
aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
is

SCOP Domain Coordinates for d1t6gc_:

Click to download the PDB-style file with coordinates for d1t6gc_.
(The format of our PDB-style files is described here.)

Timeline for d1t6gc_: