Lineage for d1t6gb_ (1t6g B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. Protein Xylanase inhibitor TAXI-I [110247] (1 species)
    pepsin-like protein that probably lost the protease activity
  7. Species Wheat (Triticum aestivum) [TaxId:4565] [110248] (4 PDB entries)
    Uniprot Q8H0K8 22-402
  8. Domain d1t6gb_: 1t6g B: [106568]
    Other proteins in same PDB: d1t6gc_, d1t6gd_
    complexed with gol

Details for d1t6gb_

PDB Entry: 1t6g (more details), 1.8 Å

PDB Description: Crystal structure of the Triticum aestivum xylanase inhibitor-I in complex with aspergillus niger xylanase-I
PDB Compounds: (B:) Xylanase inhibitor

SCOPe Domain Sequences for d1t6gb_:

Sequence, based on SEQRES records: (download)

>d1t6gb_ b.50.1.2 (B:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]}
lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
ypapgcpapscgsdkhdkpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgv
laacapskllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgg
gpvpwpqftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpy
vllrpdvyrplmdaftkalaaqhangapvaraveavapfgvcydtktlgnnlggyavpnv
qlgldggsdwtmtgknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldf
dmekkrlgfsrlphftgcggl

Sequence, based on observed residues (ATOM records): (download)

>d1t6gb_ b.50.1.2 (B:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]}
lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
ypapgcpapctaypynpvsgacaagslshtrfvanttdgskpvskvnvgvlaacapskll
aslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgggpvpwpqftq
smpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpyvllrpdvyrp
lmdaftkalaaqgapvaraveavapfgvcydtktlgnnlggyavpnvqlgldggsdwtmt
gknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldfdmekkrlgfsrlp
hftgcggl

SCOPe Domain Coordinates for d1t6gb_ are not available.

Timeline for d1t6gb_:

Domains from other chains:
(mouse over for more information)
d1t6ga_, d1t6gc_, d1t6gd_