Lineage for d1t6db2 (1t6d B:133-307)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858265Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins)
    Pfam PF02541
  6. 1858266Protein Exopolyphosphatase Ppx [110631] (2 species)
  7. 1858267Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries)
    Uniprot O67040
  8. 1858273Domain d1t6db2: 1t6d B:133-307 [106563]
    complexed with cl, trs

Details for d1t6db2

PDB Entry: 1t6d (more details), 2.15 Å

PDB Description: miras phasing of the aquifex aeolicus ppx/gppa phosphatase: crystal structure of the type ii variant
PDB Compounds: (B:) exopolyphosphatase

SCOPe Domain Sequences for d1t6db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6db2 c.55.1.8 (B:133-307) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]}
pegevmvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkrffefl
ekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdtfkeip
seerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvseml

SCOPe Domain Coordinates for d1t6db2:

Click to download the PDB-style file with coordinates for d1t6db2.
(The format of our PDB-style files is described here.)

Timeline for d1t6db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6db1