SCOPe 2.07: Domain d1t6ca1: 1t6c A:7-132

Lineage for d1t6ca1 (1t6c A:7-132)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins)
   Pfam PF02541

6. Protein Exopolyphosphatase Ppx [110631] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries)
   Uniprot O67040

8. Domain d1t6ca1: 1t6c A:7-132 [106558]
   complexed with ca, cl, iod, mpd

Details for d1t6ca1

PDB Entry: 1t6c, 1.53 Å

PDB Description: Structural characterization of the Ppx/GppA protein family: crystal structure of the Aquifex aeolicus family member

PDB Compounds: (A:) exopolyphosphatase

SCOPe Domain Sequences for d1t6ca1:

Sequence; same for both SEQRES and ATOM records:

>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]}
pimrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqv
lkeykklidefkvervkavateairraknaeeflervkrevglvvevitpeqegryayla
vayslk

Timeline for d1t6ca1:

• d1t6ca1 first appeared in SCOP 1.69
  
• d1t6ca1 appears in SCOPe 2.06
  
• d1t6ca1 appears in the current release, SCOPe 2.08