Lineage for d1t6ca1 (1t6c A:7-132)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884542Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins)
    Pfam PF02541
  6. 2884543Protein Exopolyphosphatase Ppx [110631] (2 species)
  7. 2884544Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries)
    Uniprot O67040
  8. 2884545Domain d1t6ca1: 1t6c A:7-132 [106558]
    complexed with ca, cl, iod, mpd

Details for d1t6ca1

PDB Entry: 1t6c (more details), 1.53 Å

PDB Description: Structural characterization of the Ppx/GppA protein family: crystal structure of the Aquifex aeolicus family member
PDB Compounds: (A:) exopolyphosphatase

SCOPe Domain Sequences for d1t6ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]}
pimrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqv
lkeykklidefkvervkavateairraknaeeflervkrevglvvevitpeqegryayla
vayslk

SCOPe Domain Coordinates for d1t6ca1:

Click to download the PDB-style file with coordinates for d1t6ca1.
(The format of our PDB-style files is described here.)

Timeline for d1t6ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6ca2