Lineage for d1t6bx_ (1t6b X:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058694Fold f.11: Anthrax protective antigen [56987] (1 superfamily)
    4 domains; I (res. 14-225) and II (226-487) are beta-sandwiches of similar gamma-crystallin like topologies; III (488-594) has a beta-grasp like fold; IV (595-735) has an Ig-like fold
  4. 1058695Superfamily f.11.1: Anthrax protective antigen [56988] (1 family) (S)
  5. 1058696Family f.11.1.1: Anthrax protective antigen [56989] (2 proteins)
  6. 1058697Protein Anthrax protective antigen [56990] (1 species)
  7. 1058698Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [56991] (3 PDB entries)
    Uniprot P13423
  8. 1058700Domain d1t6bx_: 1t6b X: [106556]
    Other proteins in same PDB: d1t6by_
    complexed with ca, mn, na, pg4

Details for d1t6bx_

PDB Entry: 1t6b (more details), 2.5 Å

PDB Description: Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor
PDB Compounds: (X:) Protective antigen

SCOPe Domain Sequences for d1t6bx_:

Sequence, based on SEQRES records: (download)

>d1t6bx_ f.11.1.1 (X:) Anthrax protective antigen {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
eytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkly
wtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytvd
vknkrtflspwisnihekkgltkyksspekwstasdpysdfekvtgridknvspearhpl
vaaypivhvdmeniilsknedqstqntdsqtrtiskntstsrthtsevhgnaevhasffd
iggsvsagfsnsnsstvaidhslslagertwaetmglntadtarlnaniryvntgtapiy
nvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqddfsstpitmn
ynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiqettariifng
kdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqyqgkditefdfnfd
qqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniavgadesvvkea
hrevinssteglllnidkdirkilsgyiveiedteglkevindrydmlnisslrqdgktf
idfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngikkilifskkgyeig

Sequence, based on observed residues (ATOM records): (download)

>d1t6bx_ f.11.1.1 (X:) Anthrax protective antigen {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
eytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkly
wtdsqnkkevissdnlqlpelkqvpdrdndgipdslevegytvdvknkrtflspwisnih
ekkgltkyksspekwstasdpysdfekvtgridknvspearhplvaaypivhvdmeniil
sknetiskntstsrthtsevvsagfsnsnsstvaidhslslagertwaetmglntadtar
lnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapi
alnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwse
vlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngn
lqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhyd
rnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindr
ydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstn
gikkilifskkgyeig

SCOPe Domain Coordinates for d1t6bx_:

Click to download the PDB-style file with coordinates for d1t6bx_.
(The format of our PDB-style files is described here.)

Timeline for d1t6bx_: