SCOP 1.71: Domain d1t66d1: 1t66 D:1-118

Lineage for d1t66d1 (1t66 D:1-118)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)

8. Domain d1t66d1: 1t66 D:1-118 [106547]
   Other proteins in same PDB: d1t66c1, d1t66c2, d1t66d2, d1t66h2, d1t66l1, d1t66l2

Details for d1t66d1

PDB Entry: 1t66, 2.3 Å

PDB Description: The structure of FAB with intermediate affinity for fluorescein.

SCOP Domain Sequences for d1t66d1:

Sequence; same for both SEQRES and ATOM records:

>d1t66d1 b.1.1.1 (D:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddskssvylqmnnlraedmgiyyctsygyhgaywgqgtlvtvsa

Timeline for d1t66d1:

• d1t66d1 first appeared in SCOP 1.69
  
• d1t66d1 appears in SCOP 1.73
  
• d1t66d1 appears in the current release, SCOPe 2.08