Lineage for d1t64b_ (1t64 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874190Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2874225Protein Histone deacetylase 8, HDAC8 [110587] (1 species)
  7. 2874226Species Human (Homo sapiens) [TaxId:9606] [110588] (5 PDB entries)
    Uniprot Q9BY41 13-375 ! Uniprot Q9BY41
  8. 2874228Domain d1t64b_: 1t64 B: [106544]
    complexed with ca, na, tsn, zn

Details for d1t64b_

PDB Entry: 1t64 (more details), 1.9 Å

PDB Description: Crystal Structure of human HDAC8 complexed with Trichostatin A
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d1t64b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t64b_ c.42.1.2 (B:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

SCOPe Domain Coordinates for d1t64b_:

Click to download the PDB-style file with coordinates for d1t64b_.
(The format of our PDB-style files is described here.)

Timeline for d1t64b_: