Lineage for d1t64a_ (1t64 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 485940Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 485941Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 486068Family c.42.1.2: Histone deacetylase, HDAC [52773] (2 proteins)
  6. 486075Protein Histone deacetylase 8, HDAC8 [110587] (1 species)
  7. 486076Species Human (Homo sapiens) [TaxId:9606] [110588] (5 PDB entries)
  8. 486077Domain d1t64a_: 1t64 A: [106543]

Details for d1t64a_

PDB Entry: 1t64 (more details), 1.9 Å

PDB Description: Crystal Structure of human HDAC8 complexed with Trichostatin A

SCOP Domain Sequences for d1t64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t64a_ c.42.1.2 (A:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens)}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

SCOP Domain Coordinates for d1t64a_:

Click to download the PDB-style file with coordinates for d1t64a_.
(The format of our PDB-style files is described here.)

Timeline for d1t64a_: