Lineage for d1t62a_ (1t62 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1813773Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1813774Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1813879Family b.122.1.4: Hypothetical protein EF3133 [110339] (1 protein)
    Pfam PF06171; DUF984
  6. 1813880Protein Hypothetical protein EF3133 [110340] (1 species)
  7. 1813881Species Enterococcus faecalis [TaxId:1351] [110341] (1 PDB entry)
    Uniprot Q82ZD1
  8. 1813882Domain d1t62a_: 1t62 A: [106541]
    Structural genomics target

Details for d1t62a_

PDB Entry: 1t62 (more details), 3 Å

PDB Description: crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1t62a_:

Sequence, based on SEQRES records: (download)

>d1t62a_ b.122.1.4 (A:) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
arffkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d1t62a_ b.122.1.4 (A:) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegldywyeeharffk
eelapyqlqfypdmllvcqsfevvdlythhhhh

SCOPe Domain Coordinates for d1t62a_:

Click to download the PDB-style file with coordinates for d1t62a_.
(The format of our PDB-style files is described here.)

Timeline for d1t62a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t62b_