Lineage for d1t62a1 (1t62 A:1001-1153)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2076966Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2076967Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2077074Family b.122.1.4: Hypothetical protein EF3133 [110339] (1 protein)
    Pfam PF06171; DUF984
  6. 2077075Protein Hypothetical protein EF3133 [110340] (1 species)
  7. 2077076Species Enterococcus faecalis [TaxId:1351] [110341] (1 PDB entry)
    Uniprot Q82ZD1
  8. Domain d1t62a1: 1t62 A:1001-1153 [106541]
    Other proteins in same PDB: d1t62a2, d1t62b2
    Structural genomics target

Details for d1t62a1

PDB Entry: 1t62 (more details), 3 Å

PDB Description: Crystal structure of protein EF3133 from Enterococcus faecalis V583, Pfam DUF984
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1t62a1:

Sequence, based on SEQRES records: (download)

>d1t62a1 b.122.1.4 (A:1001-1153) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
arffkeelapyqlqfypdmllvcqsfevvdlyt

Sequence, based on observed residues (ATOM records): (download)

>d1t62a1 b.122.1.4 (A:1001-1153) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegldywyeeharffk
eelapyqlqfypdmllvcqsfevvdlyt

SCOPe Domain Coordinates for d1t62a1:

Click to download the PDB-style file with coordinates for d1t62a1.
(The format of our PDB-style files is described here.)

Timeline for d1t62a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t62a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t62b1, d1t62b2