Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins) duplication: consists of two subdomains of this fold; segment swapping within and between individual domains automatically mapped to Pfam PF01413 |
Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries) Uniprot P02462 1445-1667 |
Domain d1t61b1: 1t61 B:6-114 [106531] complexed with ca, cl, gol, k |
PDB Entry: 1t61 (more details), 1.5 Å
SCOPe Domain Sequences for d1t61b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t61b1 d.169.1.6 (B:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} flvtrhsqttddpqcppgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpflfc ninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap
Timeline for d1t61b1: