Lineage for d1t61a1 (1t61 A:6-114)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608027Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 2608028Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 2608029Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries)
    Uniprot P02462 1445-1667
  8. 2608030Domain d1t61a1: 1t61 A:6-114 [106529]
    complexed with ca, cl, gol, k

Details for d1t61a1

PDB Entry: 1t61 (more details), 1.5 Å

PDB Description: crystal structure of collagen IV NC1 domain from placenta basement membrane
PDB Compounds: (A:) type iv collagen

SCOPe Domain Sequences for d1t61a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t61a1 d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}
flvtrhsqttddpqcppgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpflfc
ninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap

SCOPe Domain Coordinates for d1t61a1:

Click to download the PDB-style file with coordinates for d1t61a1.
(The format of our PDB-style files is described here.)

Timeline for d1t61a1: