Lineage for d1t60v1 (1t60 V:6-114)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514330Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 514331Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 514697Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
  6. 514698Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 514699Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries)
  8. 514740Domain d1t60v1: 1t60 V:6-114 [106525]

Details for d1t60v1

PDB Entry: 1t60 (more details), 1.5 Å

PDB Description: Crystal structure of Type IV collagen NC1 domain from bovine lens capsule

SCOP Domain Sequences for d1t60v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t60v1 d.169.1.6 (V:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus)}
flvtrhsqttddpqcppgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpflfc
ninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap

SCOP Domain Coordinates for d1t60v1:

Click to download the PDB-style file with coordinates for d1t60v1.
(The format of our PDB-style files is described here.)

Timeline for d1t60v1: