Lineage for d1t60j1 (1t60 J:6-114)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443101Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 1443102Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 1443103Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries)
    Uniprot P02462 1445-1667
  8. 1443134Domain d1t60j1: 1t60 J:6-114 [106509]
    complexed with cl, k, mpd

Details for d1t60j1

PDB Entry: 1t60 (more details), 1.5 Å

PDB Description: Crystal structure of Type IV collagen NC1 domain from bovine lens capsule
PDB Compounds: (J:) type iv collagen

SCOPe Domain Sequences for d1t60j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t60j1 d.169.1.6 (J:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}
flvtrhsqttddpqcppgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpflfc
ninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap

SCOPe Domain Coordinates for d1t60j1:

Click to download the PDB-style file with coordinates for d1t60j1.
(The format of our PDB-style files is described here.)

Timeline for d1t60j1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t60j2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t60a1, d1t60a2, d1t60b1, d1t60b2, d1t60c1, d1t60c2, d1t60d1, d1t60d2, d1t60e1, d1t60e2, d1t60f1, d1t60f2, d1t60g1, d1t60g2, d1t60h1, d1t60h2, d1t60i1, d1t60i2, d1t60k1, d1t60k2, d1t60l1, d1t60l2, d1t60m1, d1t60m2, d1t60n1, d1t60n2, d1t60o1, d1t60o2, d1t60p1, d1t60p2, d1t60q1, d1t60q2, d1t60r1, d1t60r2, d1t60s1, d1t60s2, d1t60t1, d1t60t2, d1t60u1, d1t60u2, d1t60v1, d1t60v2, d1t60w1, d1t60w2, d1t60x1, d1t60x2