Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.6: Pre-PUA domain [88802] (5 families) this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins |
Family d.17.6.3: Nip7p homolog, N-terminal domain [110832] (1 protein) |
Protein Nip7p homolog, N-terminal domain [110833] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110834] (2 PDB entries) Uniprot Q9Y221 |
Domain d1t5ya2: 1t5y A:1-94 [106496] Other proteins in same PDB: d1t5ya1 |
PDB Entry: 1t5y (more details), 2.5 Å
SCOPe Domain Sequences for d1t5ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5ya2 d.17.6.3 (A:1-94) Nip7p homolog, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mrplteeetrvmfekiakyigenlqllvdrpdgtycfrlhndrvyyvsekimklaanisg dklvslgtcfgkftkthkfrlhvtaldylapyak
Timeline for d1t5ya2: