Lineage for d1t5ya2 (1t5y A:1-94)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.6: Pre-PUA domain [88802] (5 families) 
this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins
Family d.17.6.3: Nip7p homolog, N-terminal domain [110832] (1 protein) Protein Nip7p homolog, N-terminal domain [110833] (1 species) Species Human (Homo sapiens) [TaxId:9606] [110834] (2 PDB entries)
Uniprot Q9Y221
Domain d1t5ya2: 1t5y A:1-94 [106496]
Other proteins in same PDB: d1t5ya1
Details for d1t5ya2
PDB Entry: 1t5y (more details), 2.5 Å
PDB Description: Crystal Structure of Northeast Structural Genomics Consortium Target HR2118: A Human Homolog of Saccharomyces cerevisiae Nip7p
PDB Compounds: (A:) Saccharomyces cerevisiae Nip7p homologSCOPe Domain Sequences for d1t5ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5ya2 d.17.6.3 (A:1-94) Nip7p homolog, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mrplteeetrvmfekiakyigenlqllvdrpdgtycfrlhndrvyyvsekimklaanisg
dklvslgtcfgkftkthkfrlhvtaldylapyak
SCOPe Domain Coordinates for d1t5ya2:
Click to download the PDB-style file with coordinates for d1t5ya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t5ya2:
- d1t5ya2 first appeared in SCOP 1.69
- d1t5ya2 appears in SCOPe 2.07
View in 3D
