Lineage for d1t5ya1 (1t5y A:95-170)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472865Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 472866Superfamily b.122.1: PUA domain-like [88697] (4 families) (S)
  5. 472867Family b.122.1.1: PUA domain [88698] (4 proteins)
    RNA-binding domain
  6. 472881Protein Nip7p homolog, C-terminal domain [110337] (1 species)
  7. 472882Species Human (Homo sapiens) [TaxId:9606] [110338] (1 PDB entry)
  8. 472883Domain d1t5ya1: 1t5y A:95-170 [106495]
    Other proteins in same PDB: d1t5ya2

Details for d1t5ya1

PDB Entry: 1t5y (more details), 2.5 Å

PDB Description: Crystal Structure of Northeast Structural Genomics Consortium Target HR2118: A Human Homolog of Saccharomyces cerevisiae Nip7p

SCOP Domain Sequences for d1t5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5ya1 b.122.1.1 (A:95-170) Nip7p homolog, C-terminal domain {Human (Homo sapiens)}
ykvwikpgaeqsflygnhvlksglgritentsqyqgvvvysmadiplgfgvaakstqdcr
kvdpmaivvfhqadig

SCOP Domain Coordinates for d1t5ya1:

Click to download the PDB-style file with coordinates for d1t5ya1.
(The format of our PDB-style files is described here.)

Timeline for d1t5ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t5ya2