SCOPe 2.08: Domain d1t5ya1: 1t5y A:95-170

Lineage for d1t5ya1 (1t5y A:95-170)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Nip7p homolog, C-terminal domain [110337] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110338] (2 PDB entries)
   Uniprot Q9Y221

8. Domain d1t5ya1: 1t5y A:95-170 [106495]
   Other proteins in same PDB: d1t5ya2

Details for d1t5ya1

PDB Entry: 1t5y, 2.5 Å

PDB Description: Crystal Structure of Northeast Structural Genomics Consortium Target HR2118: A Human Homolog of Saccharomyces cerevisiae Nip7p

PDB Compounds: (A:) Saccharomyces cerevisiae Nip7p homolog

SCOPe Domain Sequences for d1t5ya1:

Sequence; same for both SEQRES and ATOM records:

>d1t5ya1 b.122.1.1 (A:95-170) Nip7p homolog, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ykvwikpgaeqsflygnhvlksglgritentsqyqgvvvysmadiplgfgvaakstqdcr
kvdpmaivvfhqadig

Timeline for d1t5ya1:

• d1t5ya1 first appeared in SCOP 1.69
  
• d1t5ya1 appears in SCOPe 2.07