Lineage for d1t5xd2 (1t5x D:122-239)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894515Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1894580Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 1894581Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 1894598Domain d1t5xd2: 1t5x D:122-239 [106494]
    Other proteins in same PDB: d1t5xa1, d1t5xa2, d1t5xb1, d1t5xb2, d1t5xd1

Details for d1t5xd2

PDB Entry: 1t5x (more details), 2.5 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1t5xd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5xd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOPe Domain Coordinates for d1t5xd2:

Click to download the PDB-style file with coordinates for d1t5xd2.
(The format of our PDB-style files is described here.)

Timeline for d1t5xd2: