Lineage for d1t5xd1 (1t5x D:1-121)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1788382Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1788447Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 1788448Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 1788465Domain d1t5xd1: 1t5x D:1-121 [106493]
    Other proteins in same PDB: d1t5xa1, d1t5xa2, d1t5xb1, d1t5xb2, d1t5xd2

Details for d1t5xd1

PDB Entry: 1t5x (more details), 2.5 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1t5xd1:

Sequence, based on SEQRES records: (download)

>d1t5xd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1t5xd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegn

SCOPe Domain Coordinates for d1t5xd1:

Click to download the PDB-style file with coordinates for d1t5xd1.
(The format of our PDB-style files is described here.)

Timeline for d1t5xd1: