SCOPe 2.08: Domain d1t5xb2: 1t5x B:1-92

Lineage for d1t5xb2 (1t5x B:1-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
   Uniprot P04229 30-219

8. Domain d1t5xb2: 1t5x B:1-92 [106492]
   Other proteins in same PDB: d1t5xa1, d1t5xa2, d1t5xb1, d1t5xd1, d1t5xd2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1t5xb2

PDB Entry: 1t5x, 2.5 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1t5xb2:

Sequence; same for both SEQRES and ATOM records:

>d1t5xb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d1t5xb2:

• d1t5xb2 first appeared in SCOP 1.69
  
• d1t5xb2 appears in SCOPe 2.07