| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (29 PDB entries) probably orthologous to the mouse I-E group |
| Domain d1t5xb1: 1t5x B:93-190 [106491] Other proteins in same PDB: d1t5xa1, d1t5xa2, d1t5xb2, d1t5xd1, d1t5xd2 mutant |
PDB Entry: 1t5x (more details), 2.5 Å
SCOP Domain Sequences for d1t5xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5xb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d1t5xb1:
View in 3DDomains from other chains: (mouse over for more information) d1t5xa1, d1t5xa2, d1t5xd1, d1t5xd2 |