SCOP 1.75: Domain d1t5we2: 1t5w E:1-92

Lineage for d1t5we2 (1t5w E:1-92)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
   Uniprot P04229 30-219

8. Domain d1t5we2: 1t5w E:1-92 [106488]
   Other proteins in same PDB: d1t5wa1, d1t5wa2, d1t5wb1, d1t5wd1, d1t5wd2, d1t5we1

Details for d1t5we2

PDB Entry: 1t5w, 2.4 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)

PDB Compounds: (E:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d1t5we2:

Sequence; same for both SEQRES and ATOM records:

>d1t5we2 d.19.1.1 (E:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d1t5we2:

• d1t5we2 first appeared in SCOP 1.69
  
• d1t5we2 appears in SCOP 1.73
  
• d1t5we2 appears in SCOPe 2.01
  
• d1t5we2 appears in the current release, SCOPe 2.08