SCOP 1.71: Domain d1t5wd1: 1t5w D:82-181

Lineage for d1t5wd1 (1t5w D:82-181)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1t5wd1: 1t5w D:82-181 [106485]
   Other proteins in same PDB: d1t5wa2, d1t5wb1, d1t5wb2, d1t5wd2, d1t5we1, d1t5we2

Details for d1t5wd1

PDB Entry: 1t5w, 2.4 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)

SCOP Domain Sequences for d1t5wd1:

Sequence; same for both SEQRES and ATOM records:

>d1t5wd1 b.1.1.2 (D:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1t5wd1:

• d1t5wd1 first appeared in SCOP 1.69
  
• d1t5wd1 appears in SCOP 1.73
  
• d1t5wd1 appears in the current release, SCOPe 2.08