Lineage for d1t5wb2 (1t5w B:1-92)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501493Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (10 PDB entries)
  8. 501500Domain d1t5wb2: 1t5w B:1-92 [106484]
    Other proteins in same PDB: d1t5wa1, d1t5wa2, d1t5wb1, d1t5wd1, d1t5wd2, d1t5we1

Details for d1t5wb2

PDB Entry: 1t5w (more details), 2.4 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)

SCOP Domain Sequences for d1t5wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5wb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1t5wb2:

Click to download the PDB-style file with coordinates for d1t5wb2.
(The format of our PDB-style files is described here.)

Timeline for d1t5wb2: