Lineage for d1t5wa2 (1t5w A:4-81)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897796Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1897806Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 1897820Domain d1t5wa2: 1t5w A:4-81 [106482]
    Other proteins in same PDB: d1t5wa1, d1t5wb1, d1t5wb2, d1t5wd1, d1t5we1, d1t5we2

Details for d1t5wa2

PDB Entry: 1t5w (more details), 2.4 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1t5wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5wa2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d1t5wa2:

Click to download the PDB-style file with coordinates for d1t5wa2.
(The format of our PDB-style files is described here.)

Timeline for d1t5wa2: