![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
![]() | Domain d1t5wa1: 1t5w A:82-181 [106481] Other proteins in same PDB: d1t5wa2, d1t5wb1, d1t5wb2, d1t5wd2, d1t5we1, d1t5we2 |
PDB Entry: 1t5w (more details), 2.4 Å
SCOPe Domain Sequences for d1t5wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5wa1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1t5wa1: