Lineage for d1t5ta3 (1t5t A:361-599)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) 
Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (3 proteins) Protein Calcium ATPase [81658] (1 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (6 PDB entries) 
Domain d1t5ta3: 1t5t A:361-599 [106479]
Other proteins in same PDB: d1t5ta1, d1t5ta2, d1t5ta4
Details for d1t5ta3
PDB Entry: 1t5t (more details), 2.9 Å
PDB Description: Structure of the (SR)Ca2+-ATPase Ca2-E1-ADP:AlF4- form
SCOP Domain Sequences for d1t5ta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5ta3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus)}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
SCOP Domain Coordinates for d1t5ta3:
Click to download the PDB-style file with coordinates for d1t5ta3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t5ta3:
- d1t5ta3 is new in SCOP 1.69
- d1t5ta3 appears in SCOP 1.71
- d1t5ta3 appears in the current release, SCOPe 2.08
View in 3D
