SCOP 1.71: Domain d1t5ta2: 1t5t A:344-360,A:600-750

Lineage for d1t5ta2 (1t5t A:344-360,A:600-750)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (18 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Calcium ATPase, catalytic domain P [81656] (1 protein)
   interrupted by a large insertion, domain N

6. Protein Calcium ATPase, catalytic domain P [81655] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (9 PDB entries)

8. Domain d1t5ta2: 1t5t A:344-360,A:600-750 [106478]
   Other proteins in same PDB: d1t5ta1, d1t5ta3, d1t5ta4
   complexed with adp, alf, ca, k, mg

Details for d1t5ta2

PDB Entry: 1t5t, 2.9 Å

PDB Description: Structure of the (SR)Ca2+-ATPase Ca2-E1-ADP:AlF4- form

SCOP Domain Sequences for d1t5ta2:

Sequence; same for both SEQRES and ATOM records:

>d1t5ta2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus)}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

Timeline for d1t5ta2:

• d1t5ta2 first appeared in SCOP 1.69
  
• d1t5ta2 appears in SCOP 1.73
  
• d1t5ta2 appears in the current release, SCOPe 2.08