Lineage for d1t5ta1 (1t5t A:125-239)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 471187Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 471188Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 471189Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 471190Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (6 PDB entries)
  8. 471193Domain d1t5ta1: 1t5t A:125-239 [106477]
    Other proteins in same PDB: d1t5ta2, d1t5ta3, d1t5ta4

Details for d1t5ta1

PDB Entry: 1t5t (more details), 2.9 Å

PDB Description: Structure of the (SR)Ca2+-ATPase Ca2-E1-ADP:AlF4- form

SCOP Domain Sequences for d1t5ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5ta1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus)}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOP Domain Coordinates for d1t5ta1:

Click to download the PDB-style file with coordinates for d1t5ta1.
(The format of our PDB-style files is described here.)

Timeline for d1t5ta1: