Lineage for d1t5sa4 (1t5s A:1-124,A:240-343,A:751-994)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 520638Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 520639Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 520640Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 520641Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 520642Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (6 PDB entries)
  8. 520644Domain d1t5sa4: 1t5s A:1-124,A:240-343,A:751-994 [106476]
    Other proteins in same PDB: d1t5sa1, d1t5sa2, d1t5sa3

Details for d1t5sa4

PDB Entry: 1t5s (more details), 2.6 Å

PDB Description: Structure of the (SR)Ca2+-ATPase Ca2-E1-AMPPCP form

SCOP Domain Sequences for d1t5sa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5sa4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus)}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOP Domain Coordinates for d1t5sa4:

Click to download the PDB-style file with coordinates for d1t5sa4.
(The format of our PDB-style files is described here.)

Timeline for d1t5sa4: