SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1t5sa1 (1t5s A:125-239)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2071895Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2071896Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 protein domains)
  6. 2071897Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 2071898Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries)
    Uniprot P04191
  8. 2071926Domain d1t5sa1: 1t5s A:125-239 [106473]
    Other proteins in same PDB: d1t5sa2, d1t5sa3, d1t5sa4
    complexed with acp, ca, k, mg

Details for d1t5sa1

PDB Entry: 1t5s (more details), 2.6 Å

PDB Description: Structure of the (SR)Ca2+-ATPase Ca2-E1-AMPPCP form
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform SERCA1A

SCOPe Domain Sequences for d1t5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5sa1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d1t5sa1:

Click to download the PDB-style file with coordinates for d1t5sa1.
(The format of our PDB-style files is described here.)

Timeline for d1t5sa1: