Lineage for d1t5ra_ (1t5r A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022603Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 3022604Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 3022605Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 3022673Protein Leucocidin S component LukS-PV [111373] (1 species)
  7. 3022674Species Staphylococcus aureus bacteriophage PVL [TaxId:71366] [111374] (1 PDB entry)
    Uniprot O80066
  8. 3022675Domain d1t5ra_: 1t5r A: [106465]

Details for d1t5ra_

PDB Entry: 1t5r (more details), 2 Å

PDB Description: structure of the panton-valentine leucocidin s component from staphylococcus aureus
PDB Compounds: (A:) LukS-PV

SCOPe Domain Sequences for d1t5ra_:

Sequence, based on SEQRES records: (download)

>d1t5ra_ f.6.1.1 (A:) Leucocidin S component LukS-PV {Staphylococcus aureus bacteriophage PVL [TaxId: 71366]}
nienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyyn
ykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgps
tggngsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgyk
pysqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatrr
tthygnsylegsrihnafvnrnytvkyevnwktheikvkghn

Sequence, based on observed residues (ATOM records): (download)

>d1t5ra_ f.6.1.1 (A:) Leucocidin S component LukS-PV {Staphylococcus aureus bacteriophage PVL [TaxId: 71366]}
nienigaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyynyk
ntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnssfnys
ktisynqqnyisevehqnsksvqwgikansfitkmsghdpnlfvgykpysqnprdyfvpd
nelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatrrtnsylegsrihna
fvnrnytvkyevnwktheikvkghn

SCOPe Domain Coordinates for d1t5ra_:

Click to download the PDB-style file with coordinates for d1t5ra_.
(The format of our PDB-style files is described here.)

Timeline for d1t5ra_: