Lineage for d1t5od_ (1t5o D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496441Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 496442Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 496544Family c.124.1.5: IF2B-like (Pfam 01008) [110513] (3 proteins)
  6. 496551Protein Putative eIF-2B delta-subunit [110518] (1 species)
  7. 496552Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110519] (1 PDB entry)
  8. 496556Domain d1t5od_: 1t5o D: [106462]

Details for d1t5od_

PDB Entry: 1t5o (more details), 1.9 Å

PDB Description: crystal structure of the translation initiation factor eif-2b, subunit delta, from a. fulgidus

SCOP Domain Sequences for d1t5od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5od_ c.124.1.5 (D:) Putative eIF-2B delta-subunit {Archaeon Archaeoglobus fulgidus}
slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
vkvynpafdptplenvtaliteygviyppyevnvpkvlkf

SCOP Domain Coordinates for d1t5od_:

Click to download the PDB-style file with coordinates for d1t5od_.
(The format of our PDB-style files is described here.)

Timeline for d1t5od_: