Lineage for d1t5od1 (1t5o D:4-341)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493292Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2493293Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2493504Family c.124.1.5: IF2B-like [110513] (5 protein domains)
    Pfam PF01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
  6. 2493515Protein Putative eIF-2B delta-subunit [110518] (1 species)
  7. 2493516Species Archaeoglobus fulgidus [TaxId:2234] [110519] (1 PDB entry)
    Uniprot O29877 # AF0370
  8. 2493520Domain d1t5od1: 1t5o D:4-341 [106462]
    Other proteins in same PDB: d1t5oa2, d1t5ob2, d1t5oc2, d1t5od2

Details for d1t5od1

PDB Entry: 1t5o (more details), 1.9 Å

PDB Description: Crystal structure of the translation initiation factor eIF-2B, subunit delta, from A. fulgidus
PDB Compounds: (D:) Translation initiation factor eIF2B, subunit delta

SCOPe Domain Sequences for d1t5od1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5od1 c.124.1.5 (D:4-341) Putative eIF-2B delta-subunit {Archaeoglobus fulgidus [TaxId: 2234]}
rsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygialaar
erefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalreae
klaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkeirv
iacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdavfn
kigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiaplnvk
vynpafdptplenvtaliteygviyppyevnvpkvlkf

SCOPe Domain Coordinates for d1t5od1:

Click to download the PDB-style file with coordinates for d1t5od1.
(The format of our PDB-style files is described here.)

Timeline for d1t5od1: