Lineage for d1t5ob_ (1t5o B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885422Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1885423Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1885627Family c.124.1.5: IF2B-like [110513] (5 proteins)
    Pfam PF01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
  6. 1885638Protein Putative eIF-2B delta-subunit [110518] (1 species)
  7. 1885639Species Archaeoglobus fulgidus [TaxId:2234] [110519] (1 PDB entry)
    Uniprot O29877 # AF0370
  8. 1885641Domain d1t5ob_: 1t5o B: [106460]

Details for d1t5ob_

PDB Entry: 1t5o (more details), 1.9 Å

PDB Description: crystal structure of the translation initiation factor eif-2b, subunit delta, from a. fulgidus
PDB Compounds: (B:) Translation initiation factor eIF2B, subunit delta

SCOPe Domain Sequences for d1t5ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5ob_ c.124.1.5 (B:) Putative eIF-2B delta-subunit {Archaeoglobus fulgidus [TaxId: 2234]}
slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
vkvynpafdptplenvtaliteygviyppyevnvpkvlkf

SCOPe Domain Coordinates for d1t5ob_:

Click to download the PDB-style file with coordinates for d1t5ob_.
(The format of our PDB-style files is described here.)

Timeline for d1t5ob_: