Lineage for d1t5lb2 (1t5l B:415-595)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127512Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2127598Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
    contains large insertions in the first AAA domain
  7. 2127599Species Bacillus caldotenax [TaxId:1395] [52710] (4 PDB entries)
    Uniprot P56981
  8. 2127603Domain d1t5lb2: 1t5l B:415-595 [106458]
    complexed with zn; mutant

Details for d1t5lb2

PDB Entry: 1t5l (more details), 2.6 Å

PDB Description: Crystal structure of the DNA repair protein UvrB point mutant Y96A revealing a novel fold for domain 2
PDB Compounds: (B:) UvrABC system protein B

SCOPe Domain Sequences for d1t5lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5lb2 c.37.1.19 (B:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird
v

SCOPe Domain Coordinates for d1t5lb2:

Click to download the PDB-style file with coordinates for d1t5lb2.
(The format of our PDB-style files is described here.)

Timeline for d1t5lb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t5lb1