SCOPe 2.08: Domain d1t5lb1: 1t5l B:2-414

Lineage for d1t5lb1 (1t5l B:2-414)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Nucleotide excision repair enzyme UvrB, N-terminal domain [418968] (2 species)
   contains large insertions in the AAA domain

7. Species Bacillus caldotenax [TaxId:1395] [419430] (4 PDB entries)
   Uniprot P56981

8. Domain d1t5lb1: 1t5l B:2-414 [106457]
   Other proteins in same PDB: d1t5la2, d1t5lb2
   complexed with zn; mutant
   has additional subdomain(s) that are not in the common domain

Details for d1t5lb1

PDB Entry: 1t5l, 2.6 Å

PDB Description: Crystal structure of the DNA repair protein UvrB point mutant Y96A revealing a novel fold for domain 2

PDB Compounds: (B:) UvrABC system protein B

SCOPe Domain Sequences for d1t5lb1:

Sequence; same for both SEQRES and ATOM records:

>d1t5lb1 c.37.1.19 (B:2-414) Nucleotide excision repair enzyme UvrB, N-terminal domain {Bacillus caldotenax [TaxId: 1395]}
egrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkptl
viahnktlagqlyselkeffphnaveyfvsyydyaqpeayvpqtdtyiekdakindeidk
lrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiqy
drndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgerehv
aifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmremg
fcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqvl
vdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirp

Timeline for d1t5lb1:

• d1t5lb1 first appeared in SCOP 1.69
  
• d1t5lb1 appears in SCOPe 2.07