SCOPe 2.08: Domain d1t5la2: 1t5l A:415-595

Lineage for d1t5la2 (1t5l A:415-595)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Nucleotide excision repair enzyme UvrB, C-terminal domain [418969] (2 species)
7. Species Bacillus caldotenax [TaxId:1395] [419431] (4 PDB entries)
   Uniprot P56981

8. Domain d1t5la2: 1t5l A:415-595 [106456]
   Other proteins in same PDB: d1t5la1, d1t5lb1
   complexed with zn; mutant

Details for d1t5la2

PDB Entry: 1t5l, 2.6 Å

PDB Description: Crystal structure of the DNA repair protein UvrB point mutant Y96A revealing a novel fold for domain 2

PDB Compounds: (A:) UvrABC system protein B

SCOPe Domain Sequences for d1t5la2:

Sequence; same for both SEQRES and ATOM records:

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB, C-terminal domain {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird
v

Timeline for d1t5la2:

• d1t5la2 first appeared in SCOP 1.69
  
• d1t5la2 appears in SCOPe 2.07