| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Nucleotide excision repair enzyme UvrB, N-terminal domain [418968] (2 species) contains large insertions in the AAA domain |
| Species Bacillus caldotenax [TaxId:1395] [419430] (4 PDB entries) Uniprot P56981 |
| Domain d1t5la1: 1t5l A:2-414 [106455] Other proteins in same PDB: d1t5la2, d1t5lb2 complexed with zn; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 1t5l (more details), 2.6 Å
SCOPe Domain Sequences for d1t5la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB, N-terminal domain {Bacillus caldotenax [TaxId: 1395]}
egrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkptl
viahnktlagqlyselkeffphnaveyfvsyydyaqpeayvpqtdtyiekdakindeidk
lrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiqy
drndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgerehv
aifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmremg
fcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqvl
vdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirp
Timeline for d1t5la1: