Lineage for d1t5hx_ (1t5h X:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618928Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 618929Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (1 family) (S)
  5. 618930Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (6 proteins)
  6. 618931Protein 4-chlorobenzoyl CoA ligase [111316] (1 species)
  7. 618932Species Alcaligenes sp. AL3007 [TaxId:206162] [111317] (2 PDB entries)
  8. 618933Domain d1t5hx_: 1t5h X: [106449]
    complexed with ca; mutant

Details for d1t5hx_

PDB Entry: 1t5h (more details), 2 Å

PDB Description: 4-chlorobenzoyl-coa ligase/synthetase unliganded, selenomethionine

SCOP Domain Sequences for d1t5hx_:

Sequence, based on SEQRES records: (download)

>d1t5hx_ e.23.1.1 (X:) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. AL3007}
mqtvnemlrraatrapdhcalavparglrlthaelrarveavaarlhadglrpqqrvavv
apnsadvviailalhrlgavpallnprlksaelaelikrgemtaaviavgrqvadaifqs
gsgariiflgdlvrdgepysygppiedpqrepaqpafifytsgttglpkaaiipqraaes
rvlfmstqvglrhgrhnvvlglmplyhvvgffavlvaalaldgtyvvveefrpvdalqlv
qqeqvtslfatpthldalaaaaahagsslkldslrhvtfagatmpdavletvhqhlpgek
vniygtteamnslymrqpktgtemapgffsevrivrigggvdeivangeegelivaasds
afvgylnqpqataeklqdgwyrtsdvavwtpegtvrilgrvddmiisggenihpseierv
lgtapgvtevvvigladqrwgqsvtacvvprlgetlsadaldtfcrsseladfkrpkryf
ildqlpknalnkvlrrqlvqqvs

Sequence, based on observed residues (ATOM records): (download)

>d1t5hx_ e.23.1.1 (X:) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. AL3007}
mqtvnemlrraatrapdhcalavparglrlthaelrarveavaarlhadglrpqqrvavv
apnsadvviailalhrlgavpallnprlksaelaelikrgemtaaviavqvadaifqsgs
gariiflgdlvrdgepysygppiedpqrepaqpafifytsglpkaaiipqraaesrvlfm
stqvglrhgrhnvvlglmplyhvvgffavlvaalaldgtyvvveefrpvdalqlvqqeqv
tslfatpthldalaaaaahagsslkldslrhvtfagatmpdavletvhqhlpgekvniyg
tteamnslymrqpktgtemapgffsevrivrigggvdeivangeegelivaasdsafvgy
lnqpqataeklqdgwyrtsdvavwtpegtvrilgrvddmiisggenihpseiervlgtap
gvtevvvigladqrwgqsvtacvvprlgetlsadaldtfcrsseladfkrpkryfildql
pknalnkvlrrqlvqqvs

SCOP Domain Coordinates for d1t5hx_:

Click to download the PDB-style file with coordinates for d1t5hx_.
(The format of our PDB-style files is described here.)

Timeline for d1t5hx_: