Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.46: HlyD-like secretion proteins [111368] (1 superfamily) consists of three domains: beta-barrel (res. 29-38,170-259; (50412)); barrel-sandwich hybrid (39-72,135-169; (51230)) and long alpha-hairpin (73-134; (46556)) |
Superfamily f.46.1: HlyD-like secretion proteins [111369] (2 families) |
Family f.46.1.1: HlyD-like secretion proteins [111370] (1 protein) Pfam PF00529 |
Protein Multidrug resistance protein MexA domain [111371] (1 species) periplasmic component of efflux pump; channel-forming oligomer, interacts with TolC |
Species Pseudomonas aeruginosa [TaxId:287] [111372] (2 PDB entries) Uniprot P52477 |
Domain d1t5eh_: 1t5e H: [106443] complexed with 3gr, gol |
PDB Entry: 1t5e (more details), 3 Å
SCOPe Domain Sequences for d1t5eh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5eh_ f.46.1.1 (H:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} telpgrtnafriaevrpqvngiilkrlfkegsdvkagqqlyqidpatyeadyqsaqanla stqeqaqrykllvadqavskqqyadanaaylqskaaveqarinlrytkvlspisgrigrs avtegalvtngqanamatvqqldpiyvdvtqpstallrlrrelasgqleragdnaakvsl kledgsqyplegrlefsevsvdegtgsvtiravfpnpnnellpgmfvhaql
Timeline for d1t5eh_: