Lineage for d1t5ba_ (1t5b A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 692068Family c.23.5.3: Quinone reductase [52235] (3 proteins)
    binds FAD
  6. 692069Protein ACP phosphodiesterase AcpD [110470] (2 species)
    evolved new enzymatic activity
  7. 692074Species Salmonella typhimurium [TaxId:90371] [110472] (1 PDB entry)
  8. 692075Domain d1t5ba_: 1t5b A: [106433]

Details for d1t5ba_

PDB Entry: 1t5b (more details), 1.4 Å

PDB Description: structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase
PDB Compounds: (A:) Acyl carrier protein phosphodiesterase

SCOP Domain Sequences for d1t5ba_:

Sequence, based on SEQRES records: (download)

>d1t5ba_ c.23.5.3 (A:) ACP phosphodiesterase AcpD {Salmonella typhimurium [TaxId: 602]}
mskvlvlkssilagysqsgqltdyfieqwrekhvadeitvrdlaanpvpvldgelvgamr
pgdapltprqqdalalsdeliaelkahdviviaapmynfniptqlknyfdliaragitfr
ytekgpeglvtgkravvlssrggihkdtptdliapylkvflgfigitdvnfvfaegiayg
pevaakaqadakaaidsvvaa

Sequence, based on observed residues (ATOM records): (download)

>d1t5ba_ c.23.5.3 (A:) ACP phosphodiesterase AcpD {Salmonella typhimurium [TaxId: 602]}
mskvlvlkssilagysqsgqltdyfieqwrekhvadeitvrdlaanpvpvldgelvgamr
dapltprqqdalalsdeliaelkahdviviaapmynfniptqlknyfdliaragitfryt
ekgpeglvtgkravvlssrggihkdtptdliapylkvflgfigitdvnfvfaegiaygpe
vaakaqadakaaidsvvaa

SCOP Domain Coordinates for d1t5ba_:

Click to download the PDB-style file with coordinates for d1t5ba_.
(The format of our PDB-style files is described here.)

Timeline for d1t5ba_: