Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.2: MTH1675-like [110616] (2 proteins) PfamB PB019040; probable flavoenzyme, binds FMN; the phosphoribityl group binds in the equivalent site to the binding site of the PK allosteric regulator FBP |
Protein Hypothetical protein MTH1675 [110617] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [110618] (1 PDB entry) Uniprot O27711 |
Domain d1t57c_: 1t57 C: [106432] Structural genomics target complexed with fmn, mg |
PDB Entry: 1t57 (more details), 2.3 Å
SCOPe Domain Sequences for d1t57c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t57c_ c.49.1.2 (C:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]} mekkicyfeepgkentervlelvgeradqlgirnfvvasvsgetalrlsemvegnivsvt hhagfrekgqleledeardallergvnvyagshalsgvgrgisnrfggvtpveimaetlr mvsqgfkvcveiaimaadaglipvdeeviaiggtawgadtalvltpahmnsvfdlrihev iamprp
Timeline for d1t57c_: